Structure of PDB 5f0q Chain A Binding Site BS01

Receptor Information
>5f0q Chain A (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLT
LEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLK
IILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTH
YQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f0q Mechanism of Concerted RNA-DNA Primer Synthesis by the Human Primosome.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		H300 R302 H303 R306
Binding residue
(residue number reindexed from 1)		H31 R33 H34 R37
Enzymatic activity
Enzyme Commision number 2.7.7.-
Gene Ontology
Biological Process
GO:0006269 DNA replication, synthesis of primer

View graph for
Biological Process
External links
PDB RCSB:5f0q, PDBe:5f0q, PDBj:5f0q
PDBsum5f0q
PubMed26975377
UniProtP49643|PRI2_HUMAN DNA primase large subunit (Gene Name=PRIM2)

[Back to BioLiP]