Structure of PDB 5ez0 Chain A Binding Site BS01

Receptor Information
>5ez0 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRL
NEGDQVVLINGRDIAEHTHDQVVLFIKASCGELMLLVRPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ez0 Molecular Basis of the Interaction of the Human Protein Tyrosine Phosphatase Non-receptor Type 4 (PTPN4) with the Mitogen-activated Protein Kinase p38 gamma.
Resolution2.35 Å
Binding residue
(original residue number in PDB)
R527 F528 G529 F530 N531 V532 Q538 S545 H579 V583 I586
Binding residue
(residue number reindexed from 1)
R17 F18 G19 F20 N21 V22 Q28 S35 H69 V73 I76
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:5ez0, PDBe:5ez0, PDBj:5ez0
PDBsum5ez0
PubMed27246854
UniProtP29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 (Gene Name=PTPN4)

[Back to BioLiP]