Structure of PDB 5eyz Chain A Binding Site BS01

Receptor Information
>5eyz Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLN
EGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eyz Molecular Basis of the Interaction of the Human Protein Tyrosine Phosphatase Non-receptor Type 4 (PTPN4) with the Mitogen-activated Protein Kinase p38 gamma.
Resolution2.09 Å
Binding residue
(original residue number in PDB)
R527 F528 G529 F530 N531 V532 K533 Q538 S545 H579 D580 V583
Binding residue
(residue number reindexed from 1)
R16 F17 G18 F19 N20 V21 K22 Q27 S34 H68 D69 V72
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:5eyz, PDBe:5eyz, PDBj:5eyz
PDBsum5eyz
PubMed27246854
UniProtP29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 (Gene Name=PTPN4)

[Back to BioLiP]