Structure of PDB 5ev4 Chain A Binding Site BS01

Receptor Information
>5ev4 Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQ
DKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPS
VYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKD
SATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ev4 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.
Resolution1.57 Å
Binding residue
(original residue number in PDB)		R146 Q147 R150 Y152 F197 F199 K225 R227 R228 P229 H230 D231 T252 V254 K260 F262 G264 G265 N268 N289 D293 S294 L298 K300 Y302 F304 K328 K329 A335 G338 A339 K340
Binding residue
(residue number reindexed from 1)		R3 Q4 R7 Y9 F54 F56 K82 R84 R85 P86 H87 D88 T109 V111 K117 F119 G121 G122 N125 N146 D150 S151 L155 K157 Y159 F161 K185 K186 A192 G195 A196 K197
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ev4, PDBe:5ev4, PDBj:5ev4
PDBsum5ev4
PubMed26952537
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]