Structure of PDB 5ev1 Chain A Binding Site BS01

Receptor Information
>5ev1 Chain A (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQIN
QDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENP
SVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVK
DSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ev1 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.
Resolution2.037 Å
Binding residue
(original residue number in PDB)		R146 Q147 R150 Y152 K195 F197 F199 K225 R227 R228 P229 H230 D231 T252 V254 K260 F262 G265 N289 S294 Y302 F304 A335 G338 A339 K340
Binding residue
(residue number reindexed from 1)		R4 Q5 R8 Y10 K53 F55 F57 K83 R85 R86 P87 H88 D89 T110 V112 K118 F120 G123 N147 S152 Y160 F162 A193 G196 A197 K198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ev1, PDBe:5ev1, PDBj:5ev1
PDBsum5ev1
PubMed26952537
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]