Structure of PDB 5ev0 Chain A Binding Site BS01

Receptor Information
>5ev0 Chain A (length=134) Species: 4212 (Ambrosia artemisiifolia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGSWQTYVDEHLMCDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEI
NAIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKT
GQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ev0 Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G0 W3 Y6 H10 W35 Y127 M133
Binding residue
(residue number reindexed from 1)		G2 W4 Y7 H11 W36 Y128 M134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
Biological Process
GO:0042989 sequestering of actin monomers
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005938 cell cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ev0, PDBe:5ev0, PDBj:5ev0
PDBsum5ev0
PubMed27231348
UniProtQ2KN24

[Back to BioLiP]