Structure of PDB 5eq0 Chain A Binding Site BS01

Receptor Information
>5eq0 Chain A (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAA
FEERE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eq0 A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
Resolution1.18 Å
Binding residue
(original residue number in PDB)		E8 R9 V10 F11 A12 A13 W32 W35 E43 N47 L49 D50 R52 L53
Binding residue
(residue number reindexed from 1)		E2 R3 V4 F5 A6 A7 W26 W29 E37 N41 L43 D44 R46 L47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5eq0, PDBe:5eq0, PDBj:5eq0
PDBsum5eq0
PubMed26807715
UniProtQ9HC52|CBX8_HUMAN Chromobox protein homolog 8 (Gene Name=CBX8)

[Back to BioLiP]