Structure of PDB 5epk Chain A Binding Site BS01

Receptor Information
>5epk Chain A (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAF
QKKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5epk A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E9 Q10 V11 F12 A13 A14 W33 W36 E44 N48 L50 D51 R53 L54
Binding residue
(residue number reindexed from 1)		E1 Q2 V3 F4 A5 A6 W25 W28 E36 N40 L42 D43 R45 L46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5epk, PDBe:5epk, PDBj:5epk
PDBsum5epk
PubMed26807715
UniProtQ14781|CBX2_HUMAN Chromobox protein homolog 2 (Gene Name=CBX2)

[Back to BioLiP]