Structure of PDB 5epj Chain A Binding Site BS01

Receptor Information
>5epj Chain A (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE
EK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5epj Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Q9 V10 F11 A12 V13 W32 W35 E43 H47 L49 D50 R52
Binding residue
(residue number reindexed from 1)		Q1 V2 F3 A4 V5 W24 W27 E35 H39 L41 D42 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5epj, PDBe:5epj, PDBj:5epj
PDBsum5epj
PubMed
UniProtO95931|CBX7_HUMAN Chromobox protein homolog 7 (Gene Name=CBX7)

[Back to BioLiP]