Structure of PDB 5en7 Chain A Binding Site BS01

Receptor Information
>5en7 Chain A (length=177) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNTVDSIDGFCNEIT
SGNWDNVLKTVQSLKLPAKKLIDLYEHVIIELVELRELATARLVARQTDP
MILLKQIDPDRFARLESLINRPYFDGQEVYGDVSKEKRRSVIAQTLSSEV
HVVAPSRLLSLLGQSLKWQLHQGLLPP
Ligand information
>5en7 Chain B (length=16) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSENRMVRSLHRVLFK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5en7 splicing factor
Resolution2.936 Å
Binding residue
(original residue number in PDB)
W57 D58 L61 K62 Q65 E90 L96 Q100
Binding residue
(residue number reindexed from 1)
W54 D55 L58 K59 Q62 E87 L93 Q97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000398 mRNA splicing, via spliceosome

View graph for
Biological Process
External links
PDB RCSB:5en7, PDBe:5en7, PDBj:5en7
PDBsum5en7
PubMed
UniProtG5EEG7|SMU1_CAEEL Smu-1 suppressor of mec-8 and unc-52 protein (Gene Name=smu-1)

[Back to BioLiP]