Structure of PDB 5elk Chain A Binding Site BS01

Receptor Information
>5elk Chain A (length=121) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYR
SSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCNDMQ
QAGSCPRGPFCAFAHIEPPPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5elk Recognition of distinct RNA motifs by the clustered CCCH zinc fingers of neuronal protein Unkempt.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y216 Y232 R284 Q287 Q288 F289 I293 K295 S296 T297 N300 R310 F313 C314 A315 F316
Binding residue
(residue number reindexed from 1)		Y13 Y29 R81 Q84 Q85 F86 I90 K92 S93 T94 N97 R107 F110 C111 A112 F113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5elk, PDBe:5elk, PDBj:5elk
PDBsum5elk
PubMed26641712
UniProtQ8BL48|UNK_MOUSE RING finger protein unkempt homolog (Gene Name=Unk)

[Back to BioLiP]