Structure of PDB 5eim Chain A Binding Site BS01

Receptor Information
>5eim Chain A (length=157) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERISMINPRVVLDENGISHRSRYFIMLCDNETAIAHAKKTSIWAVKKDSS
KRISDAYKKASVYFIFVAQQTYNALGYAQVVSDLNSTELPFWSDSSHAGG
VRIKWIKTCNLFSAEISEIVSHMDHGSEARDGMEMMYDEGSRLCTLINYA
IMKRIGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eim Structural insights into the specific recognition of DSR by the YTH domain containing protein Mmi1
Resolution1.54 Å
Binding residue
(original residue number in PDB)		N336 R338 R349 Y352 Y392 Y406 K436 T437 Y466 S470 C473 N477 M481 I484 R486
Binding residue
(residue number reindexed from 1)		N7 R9 R20 Y23 Y63 Y77 K107 T108 Y137 S141 C144 N148 M152 I155 R157
Binding affinityPDBbind-CN: Kd=1.1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5eim, PDBe:5eim, PDBj:5eim
PDBsum5eim
PubMed28735863
UniProtO74958|MMI1_SCHPO RNA binding exosome specificity factor Mmi1 (Gene Name=mmi1)

[Back to BioLiP]