Structure of PDB 5eeq Chain A Binding Site BS01

Receptor Information
>5eeq Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQ
KVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRH
CCT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eeq Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
R438 R462 K478 H479 Y480 L481 M495 D496
Binding residue
(residue number reindexed from 1)
R13 R37 K53 H54 Y55 L56 M70 D71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5eeq, PDBe:5eeq, PDBj:5eeq
PDBsum5eeq
PubMed27257138
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]