Structure of PDB 5edn Chain A Binding Site BS01

Receptor Information

>5edn Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLA

Ligand information

>5edn Chain C (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttgtgttttacgaggtcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5edn Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	R220 Y223 R258 I262 N266 K270
Binding residue (residue number reindexed from 1)	R4 Y7 R42 I46 N50 K54
Binding affinity	PDBbind-CN: Kd=46nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5edn, PDBe:5edn, PDBj:5edn
PDBsum	5edn
PubMed	29638214
UniProt	Q92826\|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]