Structure of PDB 5e50 Chain A Binding Site BS01

Receptor Information
>5e50 Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAIL
EVAGGQLRIKPIHTNPCFYQSSEKSQLLPLKPNLWCYLNPGDSFSMLVDK
YIFRILSIPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e50 Versatility in phospho-dependent molecular recognition of the XRCC1 and XRCC4 DNA-damage scaffolds by aprataxin-family FHA domains.
Resolution1.376 Å
Binding residue
(original residue number in PDB)
R27 G28 P29 K36 S39 R40 H58
Binding residue
(residue number reindexed from 1)
R32 G33 P34 K41 S44 R45 H63
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0008408 3'-5' exonuclease activity
Biological Process
GO:0006302 double-strand break repair

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5e50, PDBe:5e50, PDBj:5e50
PDBsum5e50
PubMed26519825
UniProtQ8IW19|APLF_HUMAN Aprataxin and PNK-like factor (Gene Name=APLF)

[Back to BioLiP]