Structure of PDB 5ds6 Chain A Binding Site BS01

Receptor Information

>5ds6 Chain A (length=256) Species: 83333 (Escherichia coli K-12)

VSMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAA
VRLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLK
VVRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRT
INQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKF
DTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLIPLIEDVLAAG
EIQPPA

Ligand information

>5ds6 Chain G (length=29)

taaacaccagaacgagtagtaaattgggc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5ds6 Foreign DNA capture during CRISPR-Cas adaptive immunity.
• Resolution: 3.352 Å
• Binding residue (original residue number in PDB): Y22 G79 E80 R84 Y86 R163 S181 Y188 H208 K211 Y217 R248
• Binding residue (residue number reindexed from 1): Y8 G65 E66 R70 Y72 R149 S156 Y163 H183 K186 Y192 R223

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5ds6, PDBe:5ds6, PDBj:5ds6
• PDBsum: 5ds6
• PubMed: 26503043
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)