Structure of PDB 5dn2 Chain A Binding Site BS01

Receptor Information
>5dn2 Chain A (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLD
SNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWM
VYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLE
LFGCRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dn2 Structural studies of neuropilin-2 reveal a zinc ion binding site remote from the vascular endothelial growth factor binding pocket.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
Y299 T319 D323 S349 T352 Y356 G417 I418
Binding residue
(residue number reindexed from 1)
Y26 T46 D50 S76 T79 Y83 G144 I145
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5dn2, PDBe:5dn2, PDBj:5dn2
PDBsum5dn2
PubMed26991001
UniProtO60462|NRP2_HUMAN Neuropilin-2 (Gene Name=NRP2)

[Back to BioLiP]