Structure of PDB 5dlo Chain A Binding Site BS01

Receptor Information
>5dlo Chain A (length=114) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRI
NKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMK
EVDNALMISLGLNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dlo Substrate recognition, regulation mechanism and activity regulation of MazF mRNA interferase.
Resolution1.401 Å
Binding residue
(original residue number in PDB)		L9 S18 Q20 V23 R24 P25 T47 G48 R49 K52 H58 L68 D69 S72 E77 Q78 E89
Binding residue
(residue number reindexed from 1)		L9 S18 Q20 V23 R24 P25 T47 G48 R49 K52 H58 L68 D69 S72 E77 Q78 E89
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
Biological Process
GO:0006402 mRNA catabolic process
GO:0016075 rRNA catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5dlo, PDBe:5dlo, PDBj:5dlo
PDBsum5dlo
PubMed
UniProtQ2FWI8|MAZF_STAA8 Endoribonuclease MazF (Gene Name=mazF)

[Back to BioLiP]