Structure of PDB 5djq Chain A Binding Site BS01

Receptor Information
>5djq Chain A (length=466) Species: 316 (Stutzerimonas stutzeri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSTAYSYKVVRQFAIMTVVWGIVGMGLGVFIAAQLAWPFLNFDLPWTSFG
RLRPLHTNAVIFAFGGCALFATSYYSVQRTCQTTLFAPKLAAFTFWGWQL
VILLAAISLPLGFTSSKEYAELEWPIDILITIVWVAYAVVFFGTLAKRKV
KHIYVGNWFFGAFILTVAILHVVNNLEIPVTAMKSYSLYAGATDAMVQWW
YGHNAVGFFLTAGFLGIMYYFVPKQAERPVYSYRLSIVHFWALITVYIWA
GPHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWHKLRSD
PILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWV
AMVSIGALYHLVPKVFGREQMHSIGLINTHFWLATIGTVLYIASMWVNGI
AQGLMWRAINDDGTLTYSFVESLEASHPGFVVRMIGGAIFFAGMLVMAYN
TWRTVQAAKPAEYDAA
Ligand information
>5djq Chain N (length=29) Species: 32042 (Stutzerimonas stutzeri ATCC 14405 = CCUG 16156) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MFVDNVVLAGVVTVGLMVAFLAGFGYFIW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5djq The structure of cbb3 cytochrome oxidase provides insights into proton pumping.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		W284 M291 A315 M319 F322 E323 M326 A334 L335 W341 W400 L408 R411 A412 I413
Binding residue
(residue number reindexed from 1)		W280 M287 A311 M315 F318 E319 M322 A330 L331 W337 W396 L404 R407 A408 I409
Enzymatic activity
Enzyme Commision number 7.1.1.9: cytochrome-c oxidase.
Gene Ontology
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0005506 iron ion binding
GO:0005507 copper ion binding
GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0015078 proton transmembrane transporter activity
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006119 oxidative phosphorylation
GO:0009060 aerobic respiration
GO:0015990 electron transport coupled proton transport
GO:0019411 aerobic respiration, using ferrous ions as electron donor
GO:0019646 aerobic electron transport chain
GO:0022904 respiratory electron transport chain
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0070069 cytochrome complex
GO:0098803 respiratory chain complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5djq, PDBe:5djq, PDBj:5djq
PDBsum5djq
PubMed20576851
UniProtD9IA43|CCON1_STUST Cbb3-type cytochrome c oxidase subunit CcoN1 (Gene Name=ccoN1)

[Back to BioLiP]