Structure of PDB 5det Chain A Binding Site BS01

Receptor Information
>5det Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDS
RSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5det Structural basis underlying CAC RNA recognition by the RRM domain of dimeric RNA-binding protein RBPMS.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		F27 K56 F65 E97 A99 K100 N102 T103 K104 M105
Binding residue
(residue number reindexed from 1)		F7 K36 F45 E77 A79 K80 N82 T83 K84 M85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5det, PDBe:5det, PDBj:5det
PDBsum5det
PubMed26347403
UniProtQ93062|RBPMS_HUMAN RNA-binding protein with multiple splicing (Gene Name=RBPMS)

[Back to BioLiP]