Structure of PDB 5def Chain A Binding Site BS01

Receptor Information
>5def Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDRESLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
REAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPGEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5def Increased Conformational Flexibility of HLA-B*27 Subtypes Associated With Ankylosing Spondylitis.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
Y7 H9 T24 E45 R62 E63 Q65 I66 C67 T73 E76 S77 L81 Y84 Y99 Y123 T143 K146 W147 A150 E152 Q155 L156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 H9 T24 E45 R62 E63 Q65 I66 C67 T73 E76 S77 L81 Y84 Y99 Y123 T143 K146 W147 A150 E152 Q155 L156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5def, PDBe:5def, PDBj:5def
PDBsum5def
PubMed26748477
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]