Structure of PDB 5de2 Chain A Binding Site BS01

Receptor Information
>5de2 Chain A (length=267) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFD
LMDAKARADCIKEIDLLKQLNHPNVIKFYASFIEDNELNIVLELADAGDL
SRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQ
SPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRP
DVTYVYDVAKRMHACTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5de2 Mechanistic basis of Nek7 activation through Nek9 binding and induced dimerization.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		A116 G117 D118 M122 H125 Q129 K130 R131 L132 P134 T137 K140 Y141 I169 T170 A171 H262
Binding residue
(residue number reindexed from 1)		A97 G98 D99 M103 H106 Q110 K111 R112 L113 P115 T118 K121 Y122 I150 T151 A152 H229
Enzymatic activity
Catalytic site (original residue number in PDB) D161 K163 A165 N166 D179 T199
Catalytic site (residue number reindexed from 1) D142 K144 A146 N147 D160 T166
Enzyme Commision number 2.7.11.34: NEK6-subfamily protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
GO:0140677 molecular function activator activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007346 regulation of mitotic cell cycle
GO:0016310 phosphorylation
GO:0032206 positive regulation of telomere maintenance
GO:0035865 cellular response to potassium ion
GO:0051225 spindle assembly
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
Cellular Component
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005815 microtubule organizing center
GO:0005856 cytoskeleton
GO:0005874 microtubule

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5de2, PDBe:5de2, PDBj:5de2
PDBsum5de2
PubMed26522158
UniProtQ8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 (Gene Name=NEK7)

[Back to BioLiP]