Structure of PDB 5dcv Chain A Binding Site BS01

Receptor Information
>5dcv Chain A (length=118) Species: 70601 (Pyrococcus horikoshii OT3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAE
DVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPG
KARDLVEEIAMKVRELMK
Ligand information
>5dcv Chain B (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaugguggaagcggugaagggaaaccgaguuaacccgccuaagcc
<<<..<<<<<.<<.......<<....>>...>>...>>>>>...>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dcv Structural basis for recognition of a kink-turn motif by an archaeal homologue of human RNase P protein Rpp38
Resolution3.401 Å
Binding residue
(original residue number in PDB)		K35 G36 T37 N38 E39 R46 D59 I93 V95 A96 A97 A98
Binding residue
(residue number reindexed from 1)		K29 G30 T31 N32 E33 R40 D53 I87 V89 A90 A91 A92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dcv, PDBe:5dcv, PDBj:5dcv
PDBsum5dcv
PubMed27114305
UniProtP62009|RL7A_PYRHO Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]