Structure of PDB 5d9i Chain A Binding Site BS01

Receptor Information
>5d9i Chain A (length=133) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEK
YSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNK
EYLMYSALTRDPFSVIEESLPGGLKEHDFNPES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d9i Structure-based analysis of the interaction between the simian virus 40 T-antigen origin binding domain and single-stranded DNA.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R154 T155 R202
Binding residue
(residue number reindexed from 1)		R26 T27 R74
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d9i, PDBe:5d9i, PDBj:5d9i
PDBsum5d9i
PubMed20980496
UniProtP03070|LT_SV40 Large T antigen

[Back to BioLiP]