Structure of PDB 5d7f Chain A Binding Site BS01

Receptor Information

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE
QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEH

Ligand information

GPWDSVARVL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	5d7f X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
Resolution	1.3 Å
Binding residue (original residue number in PDB)	H43 F44 L45 E46 K56 V57 T60 F77 F88
Binding residue (residue number reindexed from 1)	H43 F44 L45 E46 K56 V57 T60 F77 F88

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0044548	S100 protein binding
GO:0046872	metal ion binding
GO:0048156	tau protein binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0007155	cell adhesion
GO:0007409	axonogenesis
GO:0007417	central nervous system development
GO:0007611	learning or memory
GO:0007613	memory
GO:0008284	positive regulation of cell population proliferation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045666	positive regulation of neuron differentiation
GO:0048168	regulation of neuronal synaptic plasticity
GO:0097490	sympathetic neuron projection extension
GO:1990138	neuron projection extension
GO:1990845	adaptive thermogenesis

	Cellular Component
GO:0001726	ruffle
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0043025	neuronal cell body
GO:0043231	intracellular membrane-bounded organelle
GO:0048471	perinuclear region of cytoplasm

External links

PDB	RCSB:5d7f, PDBe:5d7f, PDBj:5d7f
PDBsum	5d7f
PubMed
UniProt	P04271\|S100B_HUMAN Protein S100-B (Gene Name=S100B)