Structure of PDB 5d7e Chain A Binding Site BS01

Receptor Information
>5d7e Chain A (length=140) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIP
ATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAG
ERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d7e Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		F27 H59 T61 F62 G80 W81 G82 G83 P85 D104 F107 L108
Binding residue
(residue number reindexed from 1)		F30 H62 T64 F65 G83 W84 G85 G86 P88 D107 F110 L111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5d7e, PDBe:5d7e, PDBj:5d7e
PDBsum5d7e
PubMed26341557
UniProtP35189|TAF14_YEAST Transcription initiation factor TFIID subunit 14 (Gene Name=TAF14)

[Back to BioLiP]