Structure of PDB 5d23 Chain A Binding Site BS01

Receptor Information
>5d23 Chain A (length=64) Species: 7091 (Bombyx mori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RATRLKRMSEYAAKRLSSETREQRAIRLARMSAYAARRLANETPAQRQAR
LLRMSAYAAKRQAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d23 Structures of an all-alpha protein running along the DNA major groove.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R130 M134 Y137 R141 R150 M157 S158 Y160 R164 L165 R173 R176 L177 M180 Y183
Binding residue
(residue number reindexed from 1)		R4 M8 Y11 R15 R24 M31 S32 Y34 R38 L39 R47 R50 L51 M54 Y57
Enzymatic activity
Enzyme Commision number ?
External links