Structure of PDB 5d13 Chain A Binding Site BS01

Receptor Information
>5d13 Chain A (length=100) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKG
DQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d13 Chemically-modified peptides as inhibitors of PDZ3 of PSD-95
Resolution2.151 Å
Binding residue
(original residue number in PDB)
L323 F325 N326 I327 V328 G329 E331 S339 H372 Y397 F400 E401
Binding residue
(residue number reindexed from 1)
L17 F19 N20 I21 V22 G23 E25 S33 H66 Y91 F94 E95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5d13, PDBe:5d13, PDBj:5d13
PDBsum5d13
PubMed
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]