Structure of PDB 5d0j Chain A Binding Site BS01

Receptor Information
>5d0j Chain A (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQ
KVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRH
CCTRVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d0j Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R438 H479 Y480 L481
Binding residue
(residue number reindexed from 1)
R13 H54 Y55 L56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5d0j, PDBe:5d0j, PDBj:5d0j
PDBsum5d0j
PubMed27257138
UniProtQ14451|GRB7_HUMAN Growth factor receptor-bound protein 7 (Gene Name=GRB7)

[Back to BioLiP]