Structure of PDB 5cy2 Chain A Binding Site BS01

Receptor Information
>5cy2 Chain A (length=177) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRIFGYARVSTSQQSLDIQIRALKDAGVKANRIFTDKASTDREGLDLLRM
KVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGDM
GQMVVTILSAVAQAERRRILERTNEGKGIKFGRRRTVDRNVVLTLHQKGT
GATEIAHQLSIARSTVYKILEDERASA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cy2 Structures of resolvase - accessory site complexes
Resolution4.0 Å
Binding residue
(original residue number in PDB)		F140 G141 R142 R143 T162 R172 Y176
Binding residue
(residue number reindexed from 1)		F131 G132 R133 R134 T153 R163 Y167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5cy2, PDBe:5cy2, PDBj:5cy2
PDBsum5cy2
PubMed
UniProtP0ADI2|TNR3_ECOLX Transposon Tn3 resolvase (Gene Name=tnpR)

[Back to BioLiP]