Structure of PDB 5ctv Chain A Binding Site BS01

Receptor Information
>5ctv Chain A (length=176) Species: 170187 (Streptococcus pneumoniae TIGR4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASMEINVSKLRTDLPQVGVQPYRQVHAHSTGNPHSTVQNEADYHWRKDPE
LGFFSHIVGNGAIMQVGPVDNGAWDVGGGWNAETYAAVELIESHSTKEEF
MTDYRLYIELLRNLADEAGLPKTLDTGSLAGIKTAEYATNNQPNNHSDHV
DPYPYLAKWGISREQFKHDIENGLTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ctv The crystal structure of the major pneumococcal autolysin LytA in complex with a large peptidoglycan fragment reveals the pivotal role of glycans for lytic activity.
Resolution1.05 Å
Binding residue
(original residue number in PDB)		E48 W72 D73 G75 N79 H144 S145 H147
Binding residue
(residue number reindexed from 1)		E50 W74 D75 G77 N81 H146 S147 H149
Enzymatic activity
Enzyme Commision number 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
Gene Ontology
Molecular Function
GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
Biological Process
GO:0009253 peptidoglycan catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ctv, PDBe:5ctv, PDBj:5ctv
PDBsum5ctv
PubMed27273793
UniProtP06653|ALYS_STRPN Autolysin (Gene Name=lytA)

[Back to BioLiP]