Structure of PDB 5cqx Chain A Binding Site BS01

Receptor Information
>5cqx Chain A (length=106) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFE
VVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGLS
HHHHHH
Ligand information
>5cqx Chain C (length=15) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HENIDWGEPKDKEVW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cqx Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
Resolution1.63 Å
Binding residue
(original residue number in PDB)		R29 T43 M45 P50 T52 K56 E61 L74 Q77 K79 I81 A82 R86
Binding residue
(residue number reindexed from 1)		R18 T32 M34 P39 T41 K45 E50 L61 Q64 K66 I68 A69 R73
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0140677 molecular function activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0016075 rRNA catabolic process
GO:0030308 negative regulation of cell growth
GO:0040008 regulation of growth
GO:0043068 positive regulation of programmed cell death
GO:0044010 single-species biofilm formation
GO:0051607 defense response to virus
Cellular Component
GO:0032991 protein-containing complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cqx, PDBe:5cqx, PDBj:5cqx
PDBsum5cqx
PubMed27026704
UniProtP0AE70|MAZF_ECOLI Endoribonuclease toxin MazF (Gene Name=mazF)

[Back to BioLiP]