Structure of PDB 5clv Chain A Binding Site BS01

Receptor Information
>5clv Chain A (length=95) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5clv Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P36 Q37 A38 R48 S52 Q53
Binding residue
(residue number reindexed from 1)		P35 Q36 A37 R47 S51 Q52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:5clv, PDBe:5clv, PDBj:5clv
PDBsum5clv
PubMed27016739
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]