Structure of PDB 5cj6 Chain A Binding Site BS01

Receptor Information

>5cj6 Chain A (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAK
ALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVF
NEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDG
LKNQKFFDELRMNYIKELDRIIACPTSCSRRFYQLTKLLDSVQPIARELH
QFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Ligand information

>5cj6 Chain B (length=10) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GAFQNLFQSV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cj6 2-Chloro-4-[[(1R,2R)-2-hydroxy-2-methyl-cyclopentyl]amino]-3-methyl-benzonitrile: A Transdermal Selective Androgen Receptor Modulator (SARM) for Muscle Atrophy.
Resolution	2.07 Å
Binding residue (original residue number in PDB)	V716 K720 Q733 M734 Q738 M894 E897
Binding residue (residue number reindexed from 1)	V46 K50 Q63 M64 Q68 M220 E223

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:5cj6, PDBe:5cj6, PDBj:5cj6
PDBsum	5cj6
PubMed	26683992
UniProt	P10275\|ANDR_HUMAN Androgen receptor (Gene Name=AR)

[Back to BioLiP]