Structure of PDB 5cd4 Chain A Binding Site BS01

Receptor Information
>5cd4 Chain A (length=199) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGC
HVLLQSAQMPVSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQ
KRLDSKGNIKRCRVPLIKEAEQIAWLQRKLGNAARVEDVHPISERPQYFS
GDGKSGKIQTVCFEGVLTINDAPALIDLVQQGIGPAKSMGCGLLSLAPL
Ligand information
>5cd4 Chain L (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auaaaccgacgguauuguucagauccuggcuugccaacaggaguuccccg
cgccagcgggg
.............................................<<<<<
<....>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cd4 Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y17 A34 R35 N91 K94 T95 I96 D98 N99 R102 S105 K106 K110 R113 V114 P115 I117 R128 K129 F149 K154 G156 K157 Q159 K187 S188
Binding residue
(residue number reindexed from 1)		Y17 A34 R35 N91 K94 T95 I96 D98 N99 R102 S105 K106 K110 R113 V114 P115 I117 R128 K129 F149 K154 G156 K157 Q159 K187 S188
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0006396 RNA processing
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cd4, PDBe:5cd4, PDBj:5cd4
PDBsum5cd4
PubMed26243775
UniProtQ46897|CAS6_ECOLI CRISPR system Cascade subunit CasE (Gene Name=casE)

[Back to BioLiP]