Structure of PDB 5cd1 Chain A Binding Site BS01

Receptor Information
>5cd1 Chain A (length=281) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIG
RPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLEL
RPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEH
RVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGG
RFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLG
TGDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Ligand information
>5cd1 Chain M (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcccggauagcucagucgguagagcaucagacuuaaucugaggguccag
gguucaagucccuguucgggcgcc
.<<<<<<...<<<<........>>>>.<<<<<.....>>>>>.....<<<
<<.......>>>>>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cd1 Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		G21 H22 Q37 T38 H40 G64 W65 H82 T84 Q85 L87 D181 I182 P183 F206 P208 C209 Q212
Binding residue
(residue number reindexed from 1)		G20 H21 Q36 T37 H39 G63 W64 H81 T83 Q84 L86 D180 I181 P182 F205 P207 C208 Q211
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0061953 mRNA (adenine-N1-)-methyltransferase activity
GO:0160107 tRNA (adenine(58)-N1)-methyltransferase activity
Biological Process
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0031515 tRNA (m1A) methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cd1, PDBe:5cd1, PDBj:5cd1
PDBsum5cd1
PubMed26470919
UniProtQ96FX7|TRM61_HUMAN tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A (Gene Name=TRMT61A)

[Back to BioLiP]