Structure of PDB 5cbx Chain A Binding Site BS01

Receptor Information

>5cbx Chain A (length=72) Species: 32644 (unidentified) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRFRKCLQAGMNLEA

Ligand information

>5cbx Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccagaacagagtgttctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5cbx Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	C431 H432 Y433 K446
Binding residue (residue number reindexed from 1)	C13 H14 Y15 K28
Binding affinity	PDBbind-CN: Kd=0.11uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5cbx, PDBe:5cbx, PDBj:5cbx
PDBsum	5cbx
PubMed	26715749
UniProt	P04150\|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]