Structure of PDB 5c7e Chain A Binding Site BS01

Receptor Information

>5c7e Chain A (length=205) Species: 4530 (Oryza sativa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEW
DEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKD
LKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKL
IEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFT
DHTCT

Ligand information

>5c7e Chain G (length=10) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SETELDLALG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c7e Structural basis for recognition of diverse transcriptional repressors by the TOPLESS family of corepressors.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	R67 Y68 K71 F74 K78 L111
Binding residue (residue number reindexed from 1)	R67 Y68 K71 F74 K78 L111

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Biological Process

External links

PDB	RCSB:5c7e, PDBe:5c7e, PDBj:5c7e
PDBsum	5c7e
PubMed	26601214
UniProt	Q5NBT9\|TPR1_ORYSJ Protein TPR1 (Gene Name=TPR1)

[Back to BioLiP]