Structure of PDB 5c5e Chain A Binding Site BS01

Receptor Information

>5c5e Chain A (length=284) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQ
IDCLILVAANPSFRAVVQQLCFEGVVVPAIVVGDRDSEDPDEPAKEQLYH
SAELHLGIHQLEQLPYQVDAALAEFLRLAPVETMADHIMLMGANHDPELS
SQQRDLAQRLQERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYRE
IVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELMDEFAKKLRV
EGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRET

Ligand information

>5c5e Chain G (length=16) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DEKSELSRIVRGVQEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5c5e Protein-Protein Interactions in the Cyanobacterial Circadian Clock: Structure of KaiA Dimer in Complex with C-Terminal KaiC Peptides at 2.8 angstrom Resolution.
Resolution	2.82 Å
Binding residue (original residue number in PDB)	N213 L263 D267 A270 H271
Binding residue (residue number reindexed from 1)	N213 L263 D267 A270 H271

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042802	identical protein binding

	Biological Process
GO:0006468	protein phosphorylation
GO:0007623	circadian rhythm
GO:0009649	entrainment of circadian clock
GO:0042753	positive regulation of circadian rhythm
GO:0048511	rhythmic process
GO:0051776	detection of redox state

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5c5e, PDBe:5c5e, PDBj:5c5e
PDBsum	5c5e
PubMed	26200123
UniProt	Q79PF6\|KAIA_SYNE7 Circadian clock oscillator protein KaiA (Gene Name=kaiA)

[Back to BioLiP]