Structure of PDB 5c3g Chain A Binding Site BS01

Receptor Information
>5c3g Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDL
TSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKE
MQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c3g Hydrocarbon constrained peptides - understanding preorganisation and binding affinity.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		E96 F97 R100 Y101 F105 Q111 E129 L130 D133 N136 G138 R139 L194 Y195
Binding residue
(residue number reindexed from 1)		E38 F39 R42 Y43 F47 Q53 E71 L72 D75 N78 G80 R81 L136 Y137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5c3g, PDBe:5c3g, PDBj:5c3g
PDBsum5c3g
PubMed28970875
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]