Structure of PDB 5c3f Chain A Binding Site BS01

Receptor Information
>5c3f Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQ
RNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFG
AFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
E
Ligand information
>5c3f Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EDIIRNIARHLAKVGDKKDRSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c3f Hydrocarbon constrained peptides - understanding preorganisation and binding affinity.
Resolution1.43 Å
Binding residue
(original residue number in PDB)		V220 H224 M231 L235 R248 V249 H252 V253 N260 G262 R263 V265 T266 F318 F319
Binding residue
(residue number reindexed from 1)		V49 H53 M60 L64 R77 V78 H81 V82 N89 G91 R92 V94 T95 F147 F148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:5c3f, PDBe:5c3f, PDBj:5c3f
PDBsum5c3f
PubMed28970875
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]