Structure of PDB 5c13 Chain A Binding Site BS01

Receptor Information
>5c13 Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPE
EMQWFCPKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c13 Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
Resolution2.101 Å
Binding residue
(original residue number in PDB)
P881 M882 I883 G884 C885 D886 D889 W891 W894 M907
Binding residue
(residue number reindexed from 1)
P26 M27 I28 G29 C30 D31 D34 W36 W39 M52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5c13, PDBe:5c13, PDBj:5c13
PDBsum5c13
PubMed
UniProtQ5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit 3 (Gene Name=TAF3)

[Back to BioLiP]