Structure of PDB 5c0m Chain A Binding Site BS01

Receptor Information
>5c0m Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVA
ARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPL
PQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVL
FEDTSYADGYSPPLNVAQRYVVAC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5c0m Chemical basis for the recognition of trimethyllysine by epigenetic reader proteins.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R116 D194 D196 Y238 Q240 T241 T242 C243 Y245 D266
Binding residue
(residue number reindexed from 1)		R3 D81 D83 Y125 Q127 T128 T129 C130 Y132 D153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:5c0m, PDBe:5c0m, PDBj:5c0m
PDBsum5c0m
PubMed26578293
UniProtQ96ES7|SGF29_HUMAN SAGA-associated factor 29 (Gene Name=SGF29)

[Back to BioLiP]