Structure of PDB 5bud Chain A Binding Site BS01

Receptor Information
>5bud Chain A (length=391) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMAKSLPLNSRSKTTALKQPRELFSYARDIDGKYVYDDPENSLSYYYLPD
STIDTGIDLQGGYSKFKKIPDEQNLADFNSLLKAIIKYETSEGKKISSDI
ITFREIMTKILSLPYNLTDPIDLYVVPFDGQLFIKSDDELDMKRRKEQEV
RMKQTNTVERYDYMKRCEYVGYKFETIATIPKPWSQVSRSQIENRNKKVV
NNYEQYLSVIRTGIGNVKLVLAGEIDCCWDYLPDEQNKKLNHYVELKTSR
IIENNSQVVSFEQKLFKAWCQCFLMGVTKIIYGFRDNNLILKNVELFNTE
EIPILIKNNPLTNAATEKKINCTNALKWYGAVVDWLNTTVDKKDEIKSYR
LKYDPVRKSFTLSETDSETNEKLRNGQLLTPEFTEWRQSLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bud Structural and biochemical studies of the distinct activity profiles of Rai1 enzymes.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		R159 M163 C166 E167 G170 Y171 E244 K246 T247 R249 Q256 S259 K263 R284
Binding residue
(residue number reindexed from 1)		R160 M164 C167 E168 G171 Y172 E245 K247 T248 R250 Q257 S260 K264 R285
Enzymatic activity
Enzyme Commision number 3.6.1.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003723 RNA binding
GO:0004518 nuclease activity
GO:0030234 enzyme regulator activity
GO:0034353 mRNA 5'-diphosphatase activity
GO:0046872 metal ion binding
GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity
GO:1990174 phosphodiesterase decapping endonuclease activity
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0110155 NAD-cap decapping
GO:1904595 positive regulation of termination of RNA polymerase II transcription
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0090730 Las1 complex
GO:0110103 RNA polymerase II termination complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bud, PDBe:5bud, PDBj:5bud
PDBsum5bud
PubMed26101253
UniProtQ5AAT0|DXO_CANAL Decapping nuclease RAI1 (Gene Name=RAI1)

[Back to BioLiP]