Structure of PDB 5bt2 Chain A Binding Site BS01

Receptor Information
>5bt2 Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIVY
FEKVGDTSLDPNDFDFTVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bt2 A/T Run Geometry of B-form DNA Is Independent of Bound Methyl-CpG Binding Domain, Cytosine Methylation and Flanking Sequence.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R111 K112 S113 D121
Binding residue
(residue number reindexed from 1)		R20 K21 S22 D30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5bt2, PDBe:5bt2, PDBj:5bt2
PDBsum5bt2
PubMed27502833
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]