Structure of PDB 5brm Chain A Binding Site BS01

Receptor Information
>5brm Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGT
NIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFR
VYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQEL
IEKL
Ligand information
>5brm Chain G (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GTMKRNATSPQVQRPSFMDYFD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5brm Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
Resolution2.651 Å
Binding residue
(original residue number in PDB)		R92 E94 Y95 H96 K153 R154 R157 Y163 F167 M171 N180 E200 E206 L207
Binding residue
(residue number reindexed from 1)		R41 E43 Y44 H45 K96 R97 R100 Y106 F110 M114 N123 E143 E149 L150
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5brm, PDBe:5brm, PDBj:5brm
PDBsum5brm
PubMed26108669
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]