Structure of PDB 5bqc Chain A Binding Site BS01

Receptor Information
>5bqc Chain A (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFST
VLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Ligand information
Ligand IDYYJ
InChIInChI=1S/C6H12O18S4/c7-6(2-21-26(11,12)13)5(24-28(17,18)19)4(23-27(14,15)16)3(22-6)1-20-25(8,9)10/h3-5,7H,1-2H2,(H,8,9,10)(H,11,12,13)(H,14,15,16)(H,17,18,19)/t3-,4-,5+,6-/m1/s1
InChIKeyUCVVRDOLNRDLDM-ARQDHWQXSA-N
SMILES
SoftwareSMILES
CACTVS 3.370O[C]1(CO[S](O)(=O)=O)O[CH](CO[S](O)(=O)=O)[CH](O[S](O)(=O)=O)[CH]1O[S](O)(=O)=O
OpenEye OEToolkits 1.7.6C(C1C(C(C(O1)(COS(=O)(=O)O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O
ACDLabs 12.01O=S(=O)(O)OCC1OC(O)(COS(=O)(=O)O)C(OS(=O)(=O)O)C1OS(=O)(=O)O
OpenEye OEToolkits 1.7.6C([C@@H]1[C@H]([C@@H]([C@](O1)(COS(=O)(=O)O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O
CACTVS 3.370O[C@]1(CO[S](O)(=O)=O)O[C@H](CO[S](O)(=O)=O)[C@@H](O[S](O)(=O)=O)[C@@H]1O[S](O)(=O)=O
FormulaC6 H12 O18 S4
Name1,3,4,6-tetra-O-sulfo-beta-D-fructofuranose
ChEMBL
DrugBank
ZINC
PDB chain5bqc Chain C Residue 2 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bqc Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R107 R115
Binding residue
(residue number reindexed from 1)		R74 R82
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005109 frizzled binding
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0000320 re-entry into mitotic cell cycle
GO:0001508 action potential
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0001890 placenta development
GO:0001974 blood vessel remodeling
GO:0002088 lens development in camera-type eye
GO:0003406 retinal pigment epithelium development
GO:0003407 neural retina development
GO:0006099 tricarboxylic acid cycle
GO:0006366 transcription by RNA polymerase II
GO:0006544 glycine metabolic process
GO:0006622 protein targeting to lysosome
GO:0006749 glutathione metabolic process
GO:0006954 inflammatory response
GO:0007033 vacuole organization
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007224 smoothened signaling pathway
GO:0007399 nervous system development
GO:0007601 visual perception
GO:0008104 protein localization
GO:0008283 cell population proliferation
GO:0009069 serine family amino acid metabolic process
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0014004 microglia differentiation
GO:0016055 Wnt signaling pathway
GO:0016358 dendrite development
GO:0016567 protein ubiquitination
GO:0021554 optic nerve development
GO:0030182 neuron differentiation
GO:0031290 retinal ganglion cell axon guidance
GO:0035426 extracellular matrix-cell signaling
GO:0035640 exploration behavior
GO:0045446 endothelial cell differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0046697 decidualization
GO:0048678 response to axon injury
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051402 neuron apoptotic process
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060041 retina development in camera-type eye
GO:0060042 retina morphogenesis in camera-type eye
GO:0060070 canonical Wnt signaling pathway
GO:0060221 retinal rod cell differentiation
GO:0060856 establishment of blood-brain barrier
GO:0060996 dendritic spine development
GO:0061298 retina vasculature development in camera-type eye
GO:0061299 retina vasculature morphogenesis in camera-type eye
GO:0061304 retinal blood vessel morphogenesis
GO:0061518 microglial cell proliferation
GO:0070086 ubiquitin-dependent endocytosis
GO:0071456 cellular response to hypoxia
GO:0097601 retina blood vessel maintenance
GO:0110135 Norrin signaling pathway
GO:1904390 cone retinal bipolar cell differentiation
GO:1990963 establishment of blood-retinal barrier
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0009986 cell surface
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5bqc, PDBe:5bqc, PDBj:5bqc
PDBsum5bqc
PubMed26158506
UniProtQ00604|NDP_HUMAN Norrin (Gene Name=NDP)

[Back to BioLiP]