Structure of PDB 5bmz Chain A Binding Site BS01

Receptor Information
>5bmz Chain A (length=139) Species: 62977 (Acinetobacter baylyi ADP1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNA
KLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKL
NQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bmz Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 24mer DNA.
Resolution3.001 Å
Binding residue
(original residue number in PDB)		R26 N60 A61 P71 Q72 N75 R98 I99
Binding residue
(residue number reindexed from 1)		R15 N49 A50 P60 Q61 N64 R87 I88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5bmz, PDBe:5bmz, PDBj:5bmz
PDBsum5bmz
PubMed
UniProtQ7X0D9

[Back to BioLiP]