Structure of PDB 5b78 Chain A Binding Site BS01

Receptor Information
>5b78 Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCL
KFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMEC
CDPPLTRMPKGMWICQICR
Ligand information
>5b78 Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKAPRKQLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5b78 Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
Resolution1.4 Å
Binding residue
(original residue number in PDB)		D210 F211 L213 R235 S236 K243 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 P301 G303
Binding residue
(residue number reindexed from 1)		D18 F19 L21 R43 S44 K51 I68 E69 A83 D84 M86 L87 F88 C89 D90 D93 P109 G111
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:5b78, PDBe:5b78, PDBj:5b78
PDBsum5b78
PubMed27775714
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]