Structure of PDB 5b77 Chain A Binding Site BS01

Receptor Information
>5b77 Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSP
ELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPP
LTRMPKGMWICQICRP
Ligand information
>5b77 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKAPRKQLATKAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5b77 Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
Resolution1.551 Å
Binding residue
(original residue number in PDB)		I208 S210 F211 L213 S236 K243 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 M300 G303
Binding residue
(residue number reindexed from 1)		I12 S14 F15 L17 S40 K47 I64 E65 A79 D80 M82 L83 F84 C85 D86 D89 M104 G107
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:5b77, PDBe:5b77, PDBj:5b77
PDBsum5b77
PubMed27775714
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]